DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b2 and timm17a

DIOPT Version :9

Sequence 1:NP_001285956.1 Gene:Tim17b2 / 44381 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001011183.1 Gene:timm17a / 496605 XenbaseID:XB-GENE-979217 Length:167 Species:Xenopus tropicalis


Alignment Length:171 Identity:104/171 - (60%)
Similarity:128/171 - (74%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGS 65
            ||||:|||||.||||||||||.||.:|||:||.:|||||:||||..|..||:.:|:|::|.:|||
 Frog     1 MEEYTREPCPWRIVDDCGGAFTMGMIGGGIFQAIKGFRNSPQGLKHRFKGSLISIRTRAPQLGGS 65

  Fly    66 FAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLLSMIEGLG 130
            ||.||.:||::|||:|..|.||||||||.|||:||.|||:||||.||.|||.:||:||::|||.|
 Frog    66 FAVWGGLFSMIDCSMVKMRGKEDPWNSITSGALTGAILAARNGAVAMVGSAAMGGILLALIEGAG 130

  Fly   131 IFFTRFAAEQFRNREPHIMPDANEGYGDFNSSGFGFPGAQQ 171
            |..||||:.||.|..|  :|:.    |.....|..|.|.||
 Frog   131 ICITRFASSQFTNVAP--IPED----GSQMPPGSPFGGYQQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 97/149 (65%)
timm17aNP_001011183.1 Tim17 1..167 CDD:382951 104/171 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 167 1.000 Domainoid score I3798
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3458
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm9374
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.