DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b2 and Tim17b1

DIOPT Version :9

Sequence 1:NP_001285956.1 Gene:Tim17b2 / 44381 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_649526.2 Gene:Tim17b1 / 40635 FlyBaseID:FBgn0037310 Length:179 Species:Drosophila melanogaster


Alignment Length:178 Identity:94/178 - (52%)
Similarity:126/178 - (70%) Gaps:17/178 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGS 65
            |.||.|||||.|||:||||||.||.:|||.||.:|||||||.|||.|::|.:||::.:|.::||:
  Fly     1 MAEYGREPCPFRIVEDCGGAFAMGALGGGAFQAIKGFRNAPSGLGYRLSGGLAAVRARSGLVGGN 65

  Fly    66 FAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLLSMIEGLG 130
            ||.|||.||.:|||||:||:||||||:|:|||.||||||:|.|..:|..||::||.||::|||:|
  Fly    66 FAVWGATFSAIDCSLVYFRKKEDPWNAIISGATTGGILAARTGLTSMLSSALVGGALLALIEGVG 130

  Fly   131 IFFTRFAAEQFRNREP----------------HIMPDANEGYGDFNSS 162
            |..:.::|:.:|...|                .:.|.| ..||:.:||
  Fly   131 IVVSHYSADSYRQVSPVERQQRYKQELLRQQKGVSPLA-ATYGEIDSS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 88/165 (53%)
Tim17b1NP_649526.2 Tim17 1..147 CDD:295283 87/145 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456975
Domainoid 1 1.000 130 1.000 Domainoid score I1702
eggNOG 1 0.900 - - E1_COG5596
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I1558
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm1125
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - P PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
1110.800

Return to query results.
Submit another query.