DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b2 and Tim23

DIOPT Version :9

Sequence 1:NP_001285956.1 Gene:Tim17b2 / 44381 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001015387.1 Gene:Tim23 / 3355096 FlyBaseID:FBgn0267976 Length:206 Species:Drosophila melanogaster


Alignment Length:128 Identity:34/128 - (26%)
Similarity:56/128 - (43%) Gaps:35/128 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GAFIM--GCVGG--GLFQGLKGFRNAPQ-GLGRRV----------AGSVAAIKTKSPVIGGSFAA 68
            |..:|  |.:||  |::.|||..:...| |..||.          :|:...:.|.:.:    ::|
  Fly    77 GTSVMIGGGIGGLAGVYNGLKVTKALEQKGKVRRTQLLNHIMKQGSGTANTLGTLTVL----YSA 137

  Fly    69 WGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLLSMIEGLGI 131
            .|.:       |..||.::|..|::::|:.||.:..|..|....|    .||.:     ||||
  Fly   138 CGVL-------LQFFRGEDDHINTVIAGSATGLLYKSTAGLRTCA----FGGAI-----GLGI 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 34/128 (27%)
Tim23NP_001015387.1 Tim17 42..188 CDD:295283 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.