DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b2 and Timm17b

DIOPT Version :9

Sequence 1:NP_001285956.1 Gene:Tim17b2 / 44381 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_035721.1 Gene:Timm17b / 21855 MGIID:1343176 Length:172 Species:Mus musculus


Alignment Length:171 Identity:100/171 - (58%)
Similarity:127/171 - (74%) Gaps:1/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGS 65
            ||||:|||||.||||||||||.||.:|||:||.:|||||||.|:..|..|||.|::.::|.||||
Mouse     1 MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRFRGSVNAVRIRAPQIGGS 65

  Fly    66 FAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLLSMIEGLG 130
            ||.||.:||.:||.||..|.||||||||.|||:||.:||:|:|..||.|||::||:||::|||:|
Mouse    66 FAVWGGLFSTIDCGLVRLRGKEDPWNSISSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVG 130

  Fly   131 IFFTRFAAEQFRNREPHIMPDANEGYGDFNSSGFGFPGAQQ 171
            |..||:.|:||||..| .:.|.::......|...|:|..||
Mouse   131 ILLTRYTAQQFRNAPP-FLEDPSQLTPKEGSPAPGYPNYQQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 94/149 (63%)
Timm17bNP_035721.1 Tim17 1..171 CDD:295283 100/171 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..172 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842456
Domainoid 1 1.000 170 1.000 Domainoid score I3755
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3486
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 1 1.010 - - QHG54844
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm8714
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.720

Return to query results.
Submit another query.