powered by:
Protein Alignment Tim17b2 and tctn-1
DIOPT Version :9
Sequence 1: | NP_001285956.1 |
Gene: | Tim17b2 / 44381 |
FlyBaseID: | FBgn0020371 |
Length: | 176 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_500628.2 |
Gene: | tctn-1 / 184035 |
WormBaseID: | WBGene00017120 |
Length: | 470 |
Species: | Caenorhabditis elegans |
Alignment Length: | 60 |
Identity: | 15/60 - (25%) |
Similarity: | 22/60 - (36%) |
Gaps: | 15/60 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 QGLKGFRNAPQGLGRRVAGSVA---AIKTKSPVIGGSFAAWGAVF----------SIVDC 78
|.:.|::...|.. ||.||:. |:.|......||.|.....| |.::|
Worm 256 QTVVGYKAGEQTY--RVKGSIPVPFAVPTLGNCYSGSIAPSPVFFLRSMSSVCTISTINC 313
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Tim17b2 | NP_001285956.1 |
Tim17 |
1..151 |
CDD:295283 |
15/60 (25%) |
tctn-1 | NP_500628.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5596 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.