DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b2 and timm-17B.2

DIOPT Version :9

Sequence 1:NP_001285956.1 Gene:Tim17b2 / 44381 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001367715.1 Gene:timm-17B.2 / 183965 WormBaseID:WBGene00017069 Length:140 Species:Caenorhabditis elegans


Alignment Length:53 Identity:28/53 - (52%)
Similarity:38/53 - (71%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IKTKSPVIGGSFAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRN 107
            ::.:|.:.|..|||||.:||.:||.||..|:|||..||||||.:||.:||.|:
 Worm     4 VRMRSTLAGVQFAAWGGLFSTIDCCLVANRKKEDSINSIVSGGLTGALLAIRS 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 28/53 (53%)
timm-17B.2NP_001367715.1 Tim17 <1..>56 CDD:413300 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.660

Return to query results.
Submit another query.