DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b2 and timm-17B.1

DIOPT Version :9

Sequence 1:NP_001285956.1 Gene:Tim17b2 / 44381 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_500627.1 Gene:timm-17B.1 / 177242 WormBaseID:WBGene00017119 Length:181 Species:Caenorhabditis elegans


Alignment Length:171 Identity:80/171 - (46%)
Similarity:109/171 - (63%) Gaps:4/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGS 65
            ||||:|||||:||.||.|.||.||.|||.:||...|::||.:  |:::.|.:..::.:|.:.|..
 Worm     1 MEEYTREPCPYRIGDDIGSAFAMGLVGGSIFQAFGGYKNAAK--GKKLVGMMREVRMRSTLTGVQ 63

  Fly    66 FAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLLSMIEGLG 130
            |||||.:||.:||.||..|:||||.||||||.:||.:||.|:|...||||||:|.|:|:||||:|
 Worm    64 FAAWGGMFSTIDCCLVAIRKKEDPINSIVSGGLTGALLAIRSGPKVMAGSAILGSVILAMIEGVG 128

  Fly   131 IFFTRFAAEQFRNREPHIMPDANEGYGDFNSSGFGFPGAQQ 171
            :..||:........:|  .|:|.:............||..|
 Worm   129 LVTTRWMGAMMDPTQP--PPEALDDPRSLGQKSQAEPGLDQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 75/149 (50%)
timm-17B.1NP_500627.1 3a0801so1tim17 1..172 CDD:130053 80/171 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162484
Domainoid 1 1.000 124 1.000 Domainoid score I3404
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I2720
Isobase 1 0.950 - 0 Normalized mean entropy S575
OMA 1 1.010 - - QHG54844
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - otm14555
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.