DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b2 and timm-23

DIOPT Version :9

Sequence 1:NP_001285956.1 Gene:Tim17b2 / 44381 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_492953.1 Gene:timm-23 / 173041 WormBaseID:WBGene00008857 Length:242 Species:Caenorhabditis elegans


Alignment Length:108 Identity:33/108 - (30%)
Similarity:49/108 - (45%) Gaps:14/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVI--GGSFA-AWGAV---FSIV 76
            ||||.:||..|.|     |....|:  .|::.|.....:..:..:  |..|| ..||:   :|.:
 Worm   118 GGAFGVGCARGAL-----GELMNPE--TRKMVGKPWMTRMVNATMKHGSGFAQPSGAIVFMYSAL 175

  Fly    77 DCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIG 119
            :..|...| .||..|...:||:||.|..|.:|..|....|::|
 Worm   176 EIGLRSVR-AEDELNGFGAGALTGAIYRSPHGLKASGVGALVG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 33/108 (31%)
timm-23NP_492953.1 Tim17 109..226 CDD:280604 33/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.