DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and YPT11

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_014095.2 Gene:YPT11 / 855412 SGDID:S000005248 Length:417 Species:Saccharomyces cerevisiae


Alignment Length:277 Identity:66/277 - (23%)
Similarity:106/277 - (38%) Gaps:97/277 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLLVIGESGVGKSSLI-----------------------------------------------R 23
            ||||:||::.|||:::|                                               :
Yeast    91 IKLLLIGDANVGKTAMILSYCRELLTRAEMSRSARLRHQQQQQHKDLGLKKTVVNHRLSMKEKRK 155

  Fly    24 RFVENKF------------------------DQNHDV------------TIGMDFKSKVMQVDGI 52
            |:..|.|                        |.||::            |||:|.|:.::.:|..
Yeast   156 RYSSNDFEKEFKDINHFADETSDFGNPNIGDDNNHEMADPNEIVIETRSTIGIDIKTNLVNIDNR 220

  Fly    53 DYKVALWDTAGAERFR-SLTPSFYRKALGAILVYDITSRDSLVK-LETWLAE-LDSYS--DNPNI 112
            .:.|.||||||.||:: ::.||.|:|....||.||||:..|... :|.|:.: |:::|  |....
Yeast   221 FFNVILWDTAGQERYQNAIIPSLYKKTNAVILTYDITNAKSFQSCMERWIVQALENFSSQDLLKA 285

  Fly   113 AIIVVGNKID--EERVVDR----EEGRKFARKHRALF---IETSAKCDQFVSDVFKDVVEKIVSS 168
            ...:||||||  :||.|..    :..::...||....   .|.|.|....|......::..:|.:
Yeast   286 RFFLVGNKIDLYKERQVTHYDVVQMVQEMQLKHGIKISGNFEVSCKWVNVVERTMNMIILDLVEN 350

  Fly   169 EYFNNGNASAGLDIASD 185
            ..|.|.:....:..:.|
Yeast   351 GCFENNDPCVSITTSDD 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 62/256 (24%)
Rab18 6..165 CDD:206656 62/255 (24%)
YPT11NP_014095.2 Rab 196..331 CDD:206640 44/134 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.