DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and RAB18

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001077675.1 Gene:RAB18 / 840987 AraportID:AT1G43890 Length:212 Species:Arabidopsis thaliana


Alignment Length:200 Identity:87/200 - (43%)
Similarity:123/200 - (61%) Gaps:6/200 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERF 67
            |...|:|:||:||||||||:..|..|.|| :...|||:|||.|.:.:.....|:|:|||||.|||
plant    11 DYLFKVLLIGDSGVGKSSLLLSFTSNTFD-DLSPTIGVDFKVKYLTIGEKKLKLAIWDTAGQERF 74

  Fly    68 RSLTPSFYRKALGAILVYDITSRDSLVKL-ETWLAELDSYSDNPNIAIIVVGNKIDE--ERVVDR 129
            |:||.|:||.|.|.|:|||:|.||:...| :.|..|:|.||.|.:...::||||:|:  ||.|.:
plant    75 RTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDIWAKEIDLYSTNQDCIKMLVGNKVDKESERAVSK 139

  Fly   130 EEGRKFARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSEYFNNGNASAG-LDIASDRDLE-ASA 192
            :||..|||::..||:|.|||....|...|:::|.||:.:.......:|.| .:|......: .|.
plant   140 KEGIDFAREYGCLFLECSAKTRVNVEQCFEELVLKILETPSLTAEGSSGGKKNIFKQNPAQTTST 204

  Fly   193 STCYC 197
            |:.||
plant   205 SSSYC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 78/162 (48%)
Rab18 6..165 CDD:206656 77/161 (48%)
RAB18NP_001077675.1 PLN03118 1..200 CDD:215587 83/189 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40765
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247169at2759
OrthoFinder 1 1.000 - - FOG0004111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101993
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2853
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.