DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and RABA1b

DIOPT Version :10

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_173136.1 Gene:RABA1b / 838263 AraportID:AT1G16920 Length:216 Species:Arabidopsis thaliana


Alignment Length:198 Identity:80/198 - (40%)
Similarity:126/198 - (63%) Gaps:11/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERF 67
            |...|:::||:||||||:|:.||.:|:|:.....|||::|.::.::|||...|..:|||||.||:
plant    11 DYLFKVVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATRTLKVDGKVVKAQIWDTAGQERY 75

  Fly    68 RSLTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKIDEERV--VDRE 130
            |::|.::||.|:||:||||:|.|.:...::.||.||.:::| |||.:::||||.|...:  |..|
plant    76 RAITSAYYRGAVGALLVYDVTRRATFENVDRWLKELKNHTD-PNIVVMLVGNKSDLRHLLAVPTE 139

  Fly   131 EGRKFARKHRALFIETSAKCDQFVSDVFKDVVEKI--VSS----EYFNNGNASA--GLDIASDRD 187
            :|:.:|.:....|:||||.....|.|.|.:|:.:|  ::|    |...:||||.  |..|....|
plant   140 DGKSYAEQESLCFMETSALEATNVEDAFAEVLTQIYRITSKKQVEAGEDGNASVPKGEKIEVKND 204

  Fly   188 LEA 190
            :.|
plant   205 VSA 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 Rab18 6..165 CDD:206656 68/160 (43%)
RABA1bNP_173136.1 Rab11_like 11..175 CDD:206660 69/164 (42%)

Return to query results.
Submit another query.