DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and RABC2A

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001332165.1 Gene:RABC2A / 831810 AraportID:AT5G03530 Length:210 Species:Arabidopsis thaliana


Alignment Length:169 Identity:76/169 - (44%)
Similarity:109/169 - (64%) Gaps:8/169 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDV--TIGMDFKSKVMQVDGIDYKVALWDTAGAE 65
            |.:.|:|:||:||||||||:..|:.:..:   |:  |||:|||.|.:.|.|...|:.:|||||.|
plant    11 DLSFKILLIGDSGVGKSSLLVSFISSSVE---DLAPTIGVDFKIKQLTVGGKRLKLTIWDTAGQE 72

  Fly    66 RFRSLTPSFYRKALGAILVYDITSRDSLVKL-ETWLAELDSYSDNPNIAIIVVGNKID--EERVV 127
            |||:||.|:||.|.|.|||||:|.|::...| :.|..|::.||.|.....::||||:|  .||.|
plant    73 RFRTLTSSYYRGAQGIILVYDVTRRETFTNLVDVWGKEIELYSTNQECVRMLVGNKVDRESERGV 137

  Fly   128 DREEGRKFARKHRALFIETSAKCDQFVSDVFKDVVEKIV 166
            .||||...|::...:|:|.||:..|.|...|:::..||:
plant   138 SREEGIALAKELNCMFLECSARTRQNVEQCFEELALKIM 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 74/164 (45%)
Rab18 6..165 CDD:206656 73/163 (45%)
RABC2ANP_001332165.1 PLN03118 1..210 CDD:215587 76/169 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40765
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247169at2759
OrthoFinder 1 1.000 - - FOG0004111
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101993
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2853
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.