DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and RAB7A

DIOPT Version :10

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_565521.1 Gene:RAB7A / 816724 AraportID:AT2G21880 Length:212 Species:Arabidopsis thaliana


Alignment Length:173 Identity:62/173 - (35%)
Similarity:96/173 - (55%) Gaps:10/173 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRSL 70
            :|::|:|:|||||:||:.::|..||::.:..|||.||.:|.:.:|.....:.:|||||.|||:||
plant    10 LKVIVLGDSGVGKTSLMNQYVYKKFNKQYKATIGADFVTKELHIDEKSVTLQIWDTAGQERFQSL 74

  Fly    71 TPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNP----NIAIIVVGNKID----EERVV 127
            ..:|||.|...:||||:.:..|...|..|..|....: ||    ....:::|||.|    ..|||
plant    75 GAAFYRGADCCVLVYDVNNLKSFETLNNWHTEFLKQA-NPMEPETFPFVLIGNKTDVDGGNSRVV 138

  Fly   128 DREEGRKF-ARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSE 169
            ..:...:: ..|....:.|||||.|..:.:.|..|....:|:|
plant   139 SNKRAIEWCGSKGNIPYHETSAKEDTNIDEAFLSVAHIALSNE 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 Rab18 6..165 CDD:206656 60/167 (36%)
RAB7ANP_565521.1 Rab7 10..181 CDD:206655 61/171 (36%)

Return to query results.
Submit another query.