DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and rab18

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001017281.1 Gene:rab18 / 550035 XenbaseID:XB-GENE-489852 Length:206 Species:Xenopus tropicalis


Alignment Length:201 Identity:102/201 - (50%)
Similarity:130/201 - (64%) Gaps:15/201 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRSL 70
            :|:|:|||||||||||:.||.::.||.....|||:|||.|.:.|||...|:|:|||||.||||:|
 Frog     9 LKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTL 73

  Fly    71 TPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKIDEE-RVVDREEGRK 134
            |||:||.|.|.|||||:|.||:..:|:.||.||::|....:|..::||||||:| |.|||.||.|
 Frog    74 TPSYYRGAQGVILVYDVTRRDTFTRLDNWLNELETYCTRNDIVKMLVGNKIDKENREVDRNEGLK 138

  Fly   135 FARKHRALFIETSAKCDQFVSDVFKDVVEKIV------SSEYFNNGNASAGLDIASDRDLEASAS 193
            |||||..||||.|||....|...|:::||||:      .||..|.|..      .|:.|......
 Frog   139 FARKHSMLFIEASAKTRDGVQCAFEELVEKIIQTPGLWESETNNRGVR------LSNEDGGGRGG 197

  Fly   194 TC--YC 197
            :|  ||
 Frog   198 SCSGYC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 92/160 (58%)
Rab18 6..165 CDD:206656 91/159 (57%)
rab18NP_001017281.1 Rab18 9..169 CDD:206656 91/159 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I3995
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40765
Inparanoid 1 1.050 161 1.000 Inparanoid score I4137
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247169at2759
OrthoFinder 1 1.000 - - FOG0004111
OrthoInspector 1 1.000 - - oto102706
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2740
SonicParanoid 1 1.000 - - X2853
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.