DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and rab18b

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001003449.1 Gene:rab18b / 445055 ZFINID:ZDB-GENE-040801-185 Length:205 Species:Danio rerio


Alignment Length:194 Identity:96/194 - (49%)
Similarity:131/194 - (67%) Gaps:2/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRSL 70
            :|:|:|||||||||||:.||.::.||.....|||:|||.|.:.:||...|:|:|||||.||||:|
Zfish     9 LKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTIAIDGNRAKLAIWDTAGQERFRTL 73

  Fly    71 TPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKIDEE-RVVDREEGRK 134
            |||:||.|.|.|||||:|.||:..|||.||.||::|....::..::||||||:: |.|||.||.|
Zfish    74 TPSYYRGAQGVILVYDVTKRDTFTKLENWLNELETYCTRNDLVKMLVGNKIDKDNREVDRNEGLK 138

  Fly   135 FARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSE-YFNNGNASAGLDIASDRDLEASASTCYC 197
            |||||..||||.|||....|...|:::||||:.:. .:.:...:.|:.::.:......|...||
Zfish   139 FARKHSMLFIEASAKTRDGVQCAFEELVEKILQTPGLWESSIQNHGVQLSDNEPQRQGACGGYC 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 91/160 (57%)
Rab18 6..165 CDD:206656 90/159 (57%)
rab18bNP_001003449.1 RAB 9..172 CDD:197555 92/162 (57%)
Rab18 9..169 CDD:206656 90/159 (57%)
Effector region. /evidence=ECO:0000250 37..45 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3395
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40765
Inparanoid 1 1.050 185 1.000 Inparanoid score I3930
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247169at2759
OrthoFinder 1 1.000 - - FOG0004111
OrthoInspector 1 1.000 - - otm26178
orthoMCL 1 0.900 - - OOG6_101993
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2740
SonicParanoid 1 1.000 - - X2853
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1313.000

Return to query results.
Submit another query.