DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and RabX1

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_524713.1 Gene:RabX1 / 44172 FlyBaseID:FBgn0015372 Length:261 Species:Drosophila melanogaster


Alignment Length:164 Identity:60/164 - (36%)
Similarity:97/164 - (59%) Gaps:5/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLLVIGESGVGKSSLIRRFVENKFDQNHD--VTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRS 69
            |:||:|..||||:.|:.|:::|...:...  .||.:.|.:..:.:|.:..|:.:|||||.||:|:
  Fly     7 KVLVLGSRGVGKTRLVIRYIKNTLHRKESEVPTIAVSFFTCNIILDEVKIKLQIWDTAGQERYRA 71

  Fly    70 LTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKID--EERVVDREEG 132
            :.|.:||.|..||||:|:|...:..::::|:.||.....:|.| :.:||||:|  .:|.|.|||.
  Fly    72 VAPMYYRNANAAILVFDLTQYKTFTEIKSWIQELHRNVQDPMI-LTLVGNKMDMQAQRAVSREEA 135

  Fly   133 RKFARKHRALFIETSAKCDQFVSDVFKDVVEKIV 166
            ..||....|.:.|||.:.||.:..||....:.:|
  Fly   136 FVFATSIGATYFETSTETDQGLEQVFISTAQGLV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 59/162 (36%)
Rab18 6..165 CDD:206656 59/161 (37%)
RabX1NP_524713.1 Ras 7..166 CDD:278499 59/159 (37%)
Rab 7..166 CDD:206640 59/159 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.