DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and RabX4

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_733043.1 Gene:RabX4 / 42960 FlyBaseID:FBgn0051118 Length:213 Species:Drosophila melanogaster


Alignment Length:206 Identity:71/206 - (34%)
Similarity:116/206 - (56%) Gaps:17/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRSLT 71
            |:||:|:|.|||:.::.|:.:.|:...:..|||:|||.|::.:||:..|:.:|||||.||||:||
  Fly    10 KVLVLGDSNVGKTCIVHRYCDEKYYDTYISTIGIDFKQKLINLDGVPIKLQIWDTAGQERFRTLT 74

  Fly    72 PSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKID---EERVVDREEGR 133
            .::||.|:|.:|:||:|:.:|...|..||..:.. :.:|::..::.|||.:   .:|:||:|.|.
  Fly    75 TAYYRGAMGILLMYDVTNLESYNNLSYWLRNIQE-NASPDVVKVLAGNKCECSATQRMVDKERGE 138

  Fly   134 KFARKHRALFIETSAKCDQFVSDVFKDVVEKIVS-----SEYFNNGNA-------SAGLDIASDR 186
            |.|......|.|.|.|.:..:.|.|..:..||..     .:.|:|..:       |.||...|..
  Fly   139 KIAENFDMPFFEVSCKSNINIEDAFLSLARKIREQRERRGDNFDNDESKDKKSPGSNGLGTFSLG 203

  Fly   187 DLEASASTCYC 197
            .| :..:.|.|
  Fly   204 SL-SGENRCTC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 61/161 (38%)
Rab18 6..165 CDD:206656 60/160 (38%)
RabX4NP_733043.1 RAB 9..170 CDD:197555 60/160 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.