DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and Rab19

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001261575.1 Gene:Rab19 / 38930 FlyBaseID:FBgn0015793 Length:219 Species:Drosophila melanogaster


Alignment Length:199 Identity:75/199 - (37%)
Similarity:117/199 - (58%) Gaps:7/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERF 67
            |...|:::||:.|.||:.::.||....:.:.|..|||:||..|.:.|:|...|:.:|||||.|||
  Fly    19 DFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQERF 83

  Fly    68 RSLTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKID--EERVVDRE 130
            |::|.|:||.|.|.::|||||.|.|...|:.|:.|:..|:.: |:.||:||||.|  |:|.||.|
  Fly    84 RTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTAS-NVLIILVGNKCDLEEQREVDFE 147

  Fly   131 EGRKFARK-HRALFI-ETSAKCDQFVSDVFKDVVEKIVSSEYFNNGN--ASAGLDIASDRDLEAS 191
            |.|:..:. ...||: |||||.:..|.|.|:.:..::......||..  ....:.:...:.|::.
  Fly   148 EARQMCQYIPEILFVMETSAKENMNVEDAFRCLANELKRQHDANNVEEVPENTITLGQGKPLKSC 212

  Fly   192 ASTC 195
            :|:|
  Fly   213 SSSC 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 69/163 (42%)
Rab18 6..165 CDD:206656 69/162 (43%)
Rab19NP_001261575.1 Rab19 19..184 CDD:133267 70/165 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.