DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and Rab9

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_609966.1 Gene:Rab9 / 35221 FlyBaseID:FBgn0032782 Length:256 Species:Drosophila melanogaster


Alignment Length:161 Identity:64/161 - (39%)
Similarity:100/161 - (62%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFR 68
            :.:|::::|:.|||||:|:.|||.|::::|:..|||::|.:|.:.|||..|.:.:|||||.||||
  Fly    11 KLLKVVILGDGGVGKSALLTRFVANRYEENNFHTIGVEFMNKDIVVDGERYTLQIWDTAGQERFR 75

  Fly    69 SLTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYS--DNPNIAIIVVGNKID---EERVVD 128
            :|...|||.:...:|.|.:..||||..|..|..|..:|:  |......||||||.|   ::|.|.
  Fly    76 ALRTPFYRGSDICLLCYALDDRDSLKGLGVWRNEFLNYADVDQDKFPFIVVGNKNDIPAQKRQVS 140

  Fly   129 REEGRKFARKHR-ALFIETSAKCDQFVSDVF 158
            .:..:::..:.: |..||||:|....|:|.|
  Fly   141 SDAVQQWCAEQKVACHIETSSKAATNVTDAF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 64/159 (40%)
Rab18 6..165 CDD:206656 64/159 (40%)
Rab9NP_609966.1 Rab9 8..178 CDD:206697 64/161 (40%)
Ras 14..177 CDD:278499 64/158 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454537
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.