DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and Rab21

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001036321.2 Gene:Rab21 / 3355163 FlyBaseID:FBgn0039966 Length:222 Species:Drosophila melanogaster


Alignment Length:156 Identity:67/156 - (42%)
Similarity:105/156 - (67%) Gaps:4/156 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQV-DGIDYKVALWDTAGAERFRSL 70
            |.:::||..|||:||:.|::|::|:..|..|:...|.|:.|.: ||...::.:|||||.|||.:|
  Fly    15 KAVLLGEGCVGKTSLVLRYMEDRFNAQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHAL 79

  Fly    71 TPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKID--EERVVDREEGR 133
            .|.:||.:.||:||||||.|||..|:::|:.||.... ...||:|:||||.|  |:|.|..:|..
  Fly    80 GPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMR-GTEIALIIVGNKTDLEEQRAVTHDEAL 143

  Fly   134 KFARKHRALFIETSAKCDQFVSDVFK 159
            ::||...|.::|||||.::.|:::|:
  Fly   144 QYARTVGAQYVETSAKENEGVAELFE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 67/156 (43%)
Rab18 6..165 CDD:206656 67/156 (43%)
Rab21NP_001036321.2 Rab21 14..176 CDD:133323 67/156 (43%)
Ras 15..177 CDD:278499 67/156 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454534
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.