DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and Rab10

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_523419.1 Gene:Rab10 / 33025 FlyBaseID:FBgn0015789 Length:204 Species:Drosophila melanogaster


Alignment Length:178 Identity:72/178 - (40%)
Similarity:112/178 - (62%) Gaps:6/178 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERF 67
            |...|||:||:|||||:.::.||.::.|......|||:|||.|.:::.|...|:.:|||||.|||
  Fly     7 DLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERF 71

  Fly    68 RSLTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKID--EERVVDRE 130
            .::|.|:||.|:|.:||||||:..|...:..||..:|.:: |.::..:::|||.|  ::|||::|
  Fly    72 HTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHA-NEDVEKMILGNKCDMTDKRVVNKE 135

  Fly   131 EGRKFARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSEYFNNGNASA 178
            .|...||:|...|:|||||.:..:...|.::.|.|:..   .:|..||
  Fly   136 RGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDK---TSGRESA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 67/161 (42%)
Rab18 6..165 CDD:206656 67/160 (42%)
Rab10NP_523419.1 Rab8_Rab10_Rab13_like 7..173 CDD:206659 69/166 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.