DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and rab18a

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_996661.1 Gene:rab18a / 325255 ZFINID:ZDB-GENE-030131-3980 Length:205 Species:Danio rerio


Alignment Length:196 Identity:97/196 - (49%)
Similarity:136/196 - (69%) Gaps:6/196 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAERFRSL 70
            :|:|:|||||||||||:.||.::.||.....|||:|||.|.:.|||...|:|:|||||.||||:|
Zfish     9 LKILIIGESGVGKSSLLLRFTDDTFDAEIGATIGVDFKVKTLAVDGNRAKLAIWDTAGQERFRTL 73

  Fly    71 TPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKID-EERVVDREEGRK 134
            |||:||.|.|.|||||::.|::..||:.||:||::|....::..::|||||| ::|.::||||.|
Zfish    74 TPSYYRGAQGVILVYDVSRRETFAKLDNWLSELETYCTRNDLVKMLVGNKIDKDDREIEREEGLK 138

  Fly   135 FARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSE-YFNNGNASAGLDIASDRDLEASASTC--Y 196
            |||||..||||:|||....|...|:::||||:.:. .:.:.:.|.|  :|.....|:|...|  |
Zfish   139 FARKHSMLFIESSAKTRDGVQCAFEELVEKILQTPGLWESMHKSRG--VALSELSESSQGGCGAY 201

  Fly   197 C 197
            |
Zfish   202 C 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 88/160 (55%)
Rab18 6..165 CDD:206656 87/159 (55%)
rab18aNP_996661.1 RAB 9..172 CDD:197555 89/162 (55%)
Rab18 9..169 CDD:206656 87/159 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3395
eggNOG 1 0.900 - - E1_KOG0080
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 185 1.000 Inparanoid score I3930
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247169at2759
OrthoFinder 1 1.000 - - FOG0004111
OrthoInspector 1 1.000 - - otm26178
orthoMCL 1 0.900 - - OOG6_101993
Panther 1 1.100 - - O PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2740
SonicParanoid 1 1.000 - - X2853
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.