DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and Rab27

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_726743.1 Gene:Rab27 / 31103 FlyBaseID:FBgn0025382 Length:236 Species:Drosophila melanogaster


Alignment Length:203 Identity:71/203 - (34%)
Similarity:118/203 - (58%) Gaps:18/203 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVD--GIDYKVAL--WDT 61
            :|....:.||:|:|||||:.|:.::.:.:|......|:|:||:.|.:..:  |..:::.|  |||
  Fly    13 LAGSGEQFLVLGDSGVGKTCLLYQYTDGRFHTQFISTVGIDFREKRLLYNSRGRRHRIHLQIWDT 77

  Fly    62 AGAERFRSLTPSFYRKALGAILVYDITSRDSLVKLETWLAEL--DSYSDNPNIAIIVVGNKID-- 122
            ||.|||||||.:|||.|:|.:|::|:||..|.::...||::|  .:||::|:  :::.|||.|  
  Fly    78 AGQERFRSLTTAFYRDAMGFLLIFDLTSEKSFLETANWLSQLRTHAYSEDPD--VVLCGNKCDLL 140

  Fly   123 EERVVDREEGRKFARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSEYFNNGNASAGLDIASDRD 187
            :.|||.|::.....|::|..:|||||.....|    |:.||.:|........||:...:.:    
  Fly   141 QLRVVSRDQVAALCRRYRLPYIETSACTGANV----KEAVELLVGRVMERIENAACNREFS---- 197

  Fly   188 LEASASTC 195
            |..:.|.|
  Fly   198 LLLTQSRC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 64/167 (38%)
Rab18 6..165 CDD:206656 64/166 (39%)
Rab27NP_726743.1 P-loop_NTPase 19..187 CDD:304359 65/173 (38%)
RAB 20..186 CDD:197555 65/171 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.