DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and Rasef

DIOPT Version :10

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001264263.1 Gene:Rasef / 298138 RGDID:1306418 Length:709 Species:Rattus norvegicus


Alignment Length:156 Identity:60/156 - (38%)
Similarity:95/156 - (60%) Gaps:9/156 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALWDTAGAER 66
            :.:|.|:::.|::.|||||.:.|..:|:|..|...|:|:||:.|.:.|||....:.||||||.||
  Rat   507 SQKAYKIVLAGDAAVGKSSFLMRLCKNEFQGNTSATLGVDFQMKTLMVDGEPTVLQLWDTAGQER 571

  Fly    67 FRSLTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKID--------E 123
            |||:..|::|||.|.:|:||:|...|.:.:..|:|.::. ..:.::.|::||||.|        .
  Rat   572 FRSIAKSYFRKADGVLLLYDVTCEKSFLNVREWVAMVED-GTHRSVPIMLVGNKADLRDAATAEN 635

  Fly   124 ERVVDREEGRKFARKHRALFIETSAK 149
            ::.:....|.|.|..:.|||.|||||
  Rat   636 QKCISSHLGEKLAMTYGALFCETSAK 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 Rab18 6..165 CDD:206656 59/152 (39%)
RasefNP_001264263.1 FRQ1 <1..73 CDD:444056
SMC_prok_B <141..>321 CDD:274008
Rab 511..675 CDD:206640 59/152 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.