DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and RAB18

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001243339.1 Gene:RAB18 / 22931 HGNCID:14244 Length:235 Species:Homo sapiens


Alignment Length:225 Identity:102/225 - (45%)
Similarity:134/225 - (59%) Gaps:34/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVDGIDYKVALW----------- 59
            :|:|:|||||||||||:.||.::.||.....|||:|||.|.:.|||...|:|:|           
Human     9 LKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWVTLHQQTANFF 73

  Fly    60 ------------------DTAGAERFRSLTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSY 106
                              ||||.||||:||||:||.|.|.|||||:|.||:.|||:.||.||::|
Human    74 LKSQIGNSPILKWAMWQYDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETY 138

  Fly   107 SDNPNIAIIVVGNKIDEE-RVVDREEGRKFARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSE- 169
            ....:|..::||||||:| |.|||.||.||||||..||||.|||....|...|:::||||:.:. 
Human   139 CTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPG 203

  Fly   170 YFNNGNASAGLDIASDRDLEASASTC--YC 197
            .:.:.|.:.|:.: |.|:.......|  ||
Human   204 LWESENQNKGVKL-SHREEGQGGGACGGYC 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 94/189 (50%)
Rab18 6..165 CDD:206656 93/188 (49%)
RAB18NP_001243339.1 Rab18 9..198 CDD:206656 93/188 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 184 1.000 Domainoid score I3409
eggNOG 1 0.900 - - E1_KOG0080
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40765
Inparanoid 1 1.050 187 1.000 Inparanoid score I3934
Isobase 1 0.950 - 0 Normalized mean entropy S547
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247169at2759
OrthoFinder 1 1.000 - - FOG0004111
OrthoInspector 1 1.000 - - oto88833
orthoMCL 1 0.900 - - OOG6_101993
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2740
SonicParanoid 1 1.000 - - X2853
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.