DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rab18 and Rab18

DIOPT Version :9

Sequence 1:NP_524744.2 Gene:Rab18 / 44360 FlyBaseID:FBgn0015794 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001265376.1 Gene:Rab18 / 19330 MGIID:102790 Length:212 Species:Mus musculus


Alignment Length:202 Identity:102/202 - (50%)
Similarity:134/202 - (66%) Gaps:11/202 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IKLLVIGESGVGKSSLIRRFVENKFDQNHDVTI------GMDFKSKVMQVDGIDYKVALWDTAGA 64
            :|:|:|||||||||||:.||.::.||.....||      |:|||.|.:.|||...|:|:|||||.
Mouse     9 LKILIIGESGVGKSSLLLRFTDDTFDPELAATIEFSFLQGVDFKVKTISVDGNKAKLAIWDTAGQ 73

  Fly    65 ERFRSLTPSFYRKALGAILVYDITSRDSLVKLETWLAELDSYSDNPNIAIIVVGNKIDEE-RVVD 128
            ||||:||||:||.|.|.|||||:|.||:.|||:.||.||::|....:|..::||||||:| |.||
Mouse    74 ERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVD 138

  Fly   129 REEGRKFARKHRALFIETSAKCDQFVSDVFKDVVEKIVSSE-YFNNGNASAGLDIASDRDLEASA 192
            |.||.||||||..||||.|||....|...|:::||||:.:. .:.:.|.:.|:.: |.|:.....
Mouse   139 RNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKL-SHREESRGG 202

  Fly   193 STC--YC 197
            ..|  ||
Mouse   203 GACGGYC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rab18NP_524744.2 RAB 6..166 CDD:197555 94/166 (57%)
Rab18 6..165 CDD:206656 93/165 (56%)
Rab18NP_001265376.1 Rab18 9..175 CDD:206656 95/173 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3395
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40765
Inparanoid 1 1.050 187 1.000 Inparanoid score I3899
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004111
OrthoInspector 1 1.000 - - oto92397
orthoMCL 1 0.900 - - OOG6_101993
Panther 1 1.100 - - LDO PTHR24073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2740
SonicParanoid 1 1.000 - - X2853
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.990

Return to query results.
Submit another query.