DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG46339 and Aopep

DIOPT Version :9

Sequence 1:NP_001263001.1 Gene:CG46339 / 44359 FlyBaseID:FBgn0285963 Length:1194 Species:Drosophila melanogaster
Sequence 2:NP_001276853.1 Gene:Aopep / 72061 MGIID:1919311 Length:823 Species:Mus musculus


Alignment Length:457 Identity:91/457 - (19%)
Similarity:153/457 - (33%) Gaps:122/457 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 YKTSYTNPDTKNEEW--------MISTQFSPVDARRAFPCFDRPDMKANFSISIVRPMQFKMALS 467
            ||   |.|:.::..|        .:.|..||::.|..|||.:.|...:.:..::.....|.:.:|
Mouse   248 YK---TKPEGQSVAWTTDQNGRPCVYTMGSPINNRALFPCQEPPVAMSTWQATVRAAASFVVLMS 309

  Fly   468 NMPKSGSRRFRRGFIRDDFETTPKMPTYLVAFIVSNMVDSR------------------------ 508
            ....:.....|.|::...:..|..||....|..|....:.:                        
Mouse   310 GENSAKPTPLREGYMSWHYYVTMPMPASTFAIAVGCWTEMKPKASPPDDLMTEHSLPLSPSEADL 374

  Fly   509 -------------------LASQD------------SGLTPRVEIWTRPQFVGMTHYAYKMVRKF 542
                               .||||            .|......:|..|..:...|         
Mouse   375 RYDNTCNHMEYPCRFQSASAASQDIIPYRVFAPVCLEGACQEALLWLIPSCLSAAH--------- 430

  Fly   543 LPYYEDFFGIKNKLPKIDLVSVP-DFGFAAMENWGLITFRDSALLVPEDLQLASSSEHMQVVAGI 606
                 ...| .:...::|::.|| :|....|.:..:|....|.|         :.:.|:   .|.
Mouse   431 -----SVLG-THPFSRLDILIVPTNFPSLGMASPHIIFLSQSTL---------TGTSHL---CGT 477

  Fly   607 -IAHELAHQWFGNLVTPKWWDDLWLKEGFACYMS------------YKALEHAHPEFQS------ 652
             :.||:||.|||..:..:.|.:.||.||||.::.            ::|||  ..|.::      
Mouse   478 RLCHEIAHSWFGLAIGARDWTEEWLSEGFATHLEDIFWAEAQQLPPHEALE--QQELRACLRWHR 540

  Fly   653 -MDTL-TMLEFKESMEHDADNTSHAISFD---VRSTNDVRRIFDPISYSKGTILLRMLNSIVGDV 712
             .|.| ...|..:.:..:.:.|.|..:..   |:...:..:.|..:.|.||..|||.|...:|:.
Mouse   541 LQDELRNSPEGMQVLRPNKEETGHVSASGASVVKHGLNPEKGFMQVHYLKGYFLLRFLTRTLGEK 605

  Fly   713 AFRSATRDLLKKFAYGNMDRDDLWAMLTRHGHEQGTLPKDLSVKQIMDSWITQPGYPVVNVERRG 777
            .:....|..:..|....:...|...||..:..|...|  .|||:.|:..|:...|.|....|.|.
Mouse   606 IYFPFLRKFVHLFHGQLILSQDFLQMLLENIPENKRL--GLSVENIVRDWLECSGIPKALQEERK 668

  Fly   778 AD 779
            |:
Mouse   669 AE 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG46339NP_001263001.1 Peptidase_M1 296..698 CDD:279741 67/374 (18%)
M1_APN_2 297..769 CDD:189008 87/445 (20%)
ERAP1_C 846..1138 CDD:288671
AopepNP_001276853.1 GluZincin 186..634 CDD:301352 79/417 (19%)
Leuk-A4-hydro_C 680..821 CDD:286244
Nucleolar localization signal. /evidence=ECO:0000269|PubMed:17803194 693..703
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845881
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.