DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drl and CG10702

DIOPT Version :9

Sequence 1:NP_001260566.1 Gene:drl / 44355 FlyBaseID:FBgn0015380 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_001188841.1 Gene:CG10702 / 35181 FlyBaseID:FBgn0032752 Length:946 Species:Drosophila melanogaster


Alignment Length:291 Identity:59/291 - (20%)
Similarity:93/291 - (31%) Gaps:98/291 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 LTRPFREYEHEPEEFNR-RLQELTVQKCRVRLSCLVQEGNFGRIYRGTYNDCQEVLVKTVAQHAS 378
            |..|....|:|.:..:| ||..|.:|.|. .|.|......:||.   .|....::|.:..|.|..
  Fly   694 LRLPGNTTEYELKALHRYRLYALQLQACN-PLGCSSHTTLYGRT---NYTMGADLLTQLYACHIP 754

  Fly   379 QLQVNLLLQESMMLYEASHPNVLSVLGISIEDYATPFVLYAATGSVRNLKSFLQDPSYARSVTTI 443
            ::...:     |...|...||.|          .|.:|::     .||  :|.|  ::...||  
  Fly   755 EMDKYI-----MRFEEPKKPNGL----------VTNYVIH-----FRN--NFSQ--THVGCVT-- 793

  Fly   444 QTVLMGSQLAMAMEHLHNHGVIHKDIAARNCVIDDQLRVKLTDSALSRDLFPGDYNSLGDGEYRP 508
                       .|:| .:.|.::.          .|:.:..|:.|:......||..:    .|.|
  Fly   794 -----------RMDH-QSAGYMYV----------KQINITFTECAVRVHSLAGDVMT----PYMP 832

  Fly   509 IKWLSLE-ALQKSHYNEGSDV------------WSFGVLMWEMCTLGKLPYAEIDPYEMEHYLKD 560
            |...|.| .||..|..|..|:            ...|:.::.:|.|                   
  Fly   833 ISLCSDEDRLQAFHSREAKDLSPEITDLPATASHGRGISIFLICFL------------------- 878

  Fly   561 GYRLAQPFNCPDELFTIM--AYCWASMPAER 589
                   |.|...|..::  ..||..:|..|
  Fly   879 -------FGCSVSLVWVLYKRRCWRKLPGLR 902

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drlNP_001260566.1 WIF 21..157 CDD:128745
PTK_Ryk 336..606 CDD:270639 52/269 (19%)
Pkinase_Tyr 343..599 CDD:285015 49/262 (19%)
CG10702NP_001188841.1 Recep_L_domain 47..159 CDD:279382
Furin-like 171..297 CDD:279142
FU 210..258 CDD:238021
Recep_L_domain 328..441 CDD:279382
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.