DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drl and Fras1

DIOPT Version :9

Sequence 1:NP_001260566.1 Gene:drl / 44355 FlyBaseID:FBgn0015380 Length:645 Species:Drosophila melanogaster
Sequence 2:XP_038947596.1 Gene:Fras1 / 289486 RGDID:1306516 Length:4014 Species:Rattus norvegicus


Alignment Length:486 Identity:95/486 - (19%)
Similarity:161/486 - (33%) Gaps:172/486 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EGAINDYALNF----AVPVPAN--------ISDVT-FTWQSLVDHPL------------------ 79
            |..||..::.|    |.|...|        |:|.| ||   .|:|.:                  
  Rat  3220 EAGINQTSVQFSWEVAAPTDGNGARSPFETITDSTPFT---SVNHKVLDSIYFSRRFHVRCVAKA 3281

  Fly    80 ---------PYSINIAT--SDTEVLPRPILNISRIGDVPVEPQTWGIALKCSGTRNAEVTVTINV 133
                     |...|:.|  :|:.:...|::..:..|   .:.|::...||....::.|....|::
  Rat  3282 VDKVGHVGTPLRSNVVTIGTDSAICHTPVVAGTARG---FQAQSFIATLKYLDVKHKEHPNRIHI 3343

  Fly   134 EV----------ILDRATNNNTNL-----IFKRKKICLREEQDSAHEEYDDDDLDLLQTARKGHG 183
            .|          ::.....:|.:.     |::::.:|..                 |.|||...|
  Rat  3344 SVQIPHQDGMLPLISTMPLHNLHFLLSESIYRQQHVCSN-----------------LVTARDLRG 3391

  Fly   184 -GDIHYVDRNDEHVVANGHQAPEKQRPVVTESPVGRGNSGGSKRDFDPMLRENLVPPASGLVTLI 247
             .:..::|....|..|.|   |...||.                .|||.:||   |....|..  
  Rat  3392 LSEAGFLDDAGLHSTALG---PGYDRPF----------------QFDPSVRE---PKTIQLYR-- 3432

  Fly   248 VGGILALVLVSTL----------ILIAYCAKGPSKRHPSNGVHLIKTSSFQRLPTISS--TAHNS 300
                 .|.|.|.:          .||..|  |.|           .|:.||...:..|  |.|..
  Rat  3433 -----HLNLKSCVWTFDAYYDMTELIDVC--GGS-----------VTADFQVRDSAQSFLTVHVP 3479

  Fly   301 IYVCPSTITPTYATLTRPFREYEHEPE-EFN---------RRLQELTVQKCRVR-LSCLVQEGNF 354
            :||     :..|.|..|.:...||..| ||:         ..:|..:|...|:: |...::|.  
  Rat  3480 LYV-----SYIYVTAPRGWASLEHHTEMEFSFFYDTVLWRTGIQTDSVLSARLQILRIYIRED-- 3537

  Fly   355 GRI---------YRG-------TYNDCQEVLVKTVAQHASQLQVNLLLQESMMLYEASHPNVLSV 403
            ||:         :||       |..|.:..::  ...|...:|.:|.|..|...:::.|....:.
  Rat  3538 GRLVIEFKTHAKFRGQFVIEHHTLPDVKSFIL--TPDHLGGIQFDLQLLWSAQTFDSPHQLWRAT 3600

  Fly   404 LGISIEDYATPFVLYAATGSVRNLKSFLQDP 434
            ...:.:||:..:.:|....:|:..:.:: ||
  Rat  3601 SSYNRKDYSGEYTIYLIPCTVQPTQPWV-DP 3630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drlNP_001260566.1 WIF 21..157 CDD:128745 29/167 (17%)
PTK_Ryk 336..606 CDD:270639 22/116 (19%)
Pkinase_Tyr 343..599 CDD:285015 20/109 (18%)
Fras1XP_038947596.1 VWC 27..86 CDD:214564
VWC 94..151 CDD:278520
VWC 158..>198 CDD:327433
VWC 224..277 CDD:278520
VWC 284..341 CDD:214564
VWC 368..415 CDD:327433
VSP 405..780 CDD:146106
VSP 728..1059 CDD:146106
FU 1045..1086 CDD:214589
Cadherin_3 1101..1197 CDD:406568
Cadherin_3 1202..1309 CDD:406568
Cadherin_3 1313..1440 CDD:406568
Cadherin_3 1448..1576 CDD:406568
Cadherin_3 1579..1693 CDD:406568
Cadherin_3 1703..1813 CDD:406568
Cadherin_3 1822..1940 CDD:406568
Cadherin_3 1943..2061 CDD:406568
Cadherin_3 2081..2181 CDD:406568
Cadherin_3 2188..2295 CDD:406568
Cadherin_3 2297..2408 CDD:406568
Cadherin_3 2427..2539 CDD:406568
Calx-beta 2555..2652 CDD:413355
Calx-beta 2677..2763 CDD:413355
caca <2782..>3049 CDD:273296
Calx-beta 3041..3135 CDD:413355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.