DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drl and Egfr

DIOPT Version :9

Sequence 1:NP_001260566.1 Gene:drl / 44355 FlyBaseID:FBgn0015380 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_113695.2 Gene:Egfr / 24329 RGDID:2543 Length:1209 Species:Rattus norvegicus


Alignment Length:389 Identity:103/389 - (26%)
Similarity:171/389 - (43%) Gaps:66/389 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 PPASGLVTLIVGGILALVLVSTLILIAYCAKGPSKRHPSNGVHLIKTSSFQRL--------PTIS 294
            |....:.|.||||:|.:|:|:..|       |...|..    |:::..:.:||        |   
  Rat   642 PKIPSIATGIVGGLLFIVVVALGI-------GLFMRRR----HIVRKRTLRRLLQERELVEP--- 692

  Fly   295 STAHNSIYVCPSTITPTYATLTRPFREYEHEPEEFNRRLQELTVQKCRVRLSCLVQEGNFGRIYR 359
                    :.||...|..|.|               |.|:|...:|.:|     :..|.||.:|:
  Rat   693 --------LTPSGEAPNQAHL---------------RILKETEFKKIKV-----LGSGAFGTVYK 729

  Fly   360 GTYNDCQE-----VLVKTVAQHASQLQVNLLLQESMMLYEASHPNVLSVLGI---SIEDYATPFV 416
            |.:....|     |.:|.:.:..|......:|.|:.::....:|:|..:|||   |.....|..:
  Rat   730 GLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLM 794

  Fly   417 LYAATGSVRNLKSFLQDPSYARSVTTIQTVLMGSQLAMAMEHLHNHGVIHKDIAARNCVIDDQLR 481
            .|..      |..::::  :..::.:...:....|:|..|.:|.:..::|:|:||||.::.....
  Rat   795 PYGC------LLDYVRE--HKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQH 851

  Fly   482 VKLTDSALSRDLFPGDYNSLGDGEYRPIKWLSLEALQKSHYNEGSDVWSFGVLMWEMCTLGKLPY 546
            ||:||..|::.|...:.....:|...||||::||::....|...|||||:||.:||:.|.|..||
  Rat   852 VKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPY 916

  Fly   547 AEIDPYEMEHYLKDGYRLAQPFNCPDELFTIMAYCWASMPAERPSFSQLQICLSEFHTQITRYV 610
            ..|...|:...|:.|.||.||..|..:::.||..||......||.|.:|.:..|:......||:
  Rat   917 DGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELILEFSKMARDPQRYL 980

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drlNP_001260566.1 WIF 21..157 CDD:128745
PTK_Ryk 336..606 CDD:270639 77/277 (28%)
Pkinase_Tyr 343..599 CDD:285015 75/263 (29%)
EgfrNP_113695.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1025
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.