DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drl and MERTK

DIOPT Version :10

Sequence 1:NP_001260566.1 Gene:drl / 44355 FlyBaseID:FBgn0015380 Length:645 Species:Drosophila melanogaster
Sequence 2:NP_006334.2 Gene:MERTK / 10461 HGNCID:7027 Length:999 Species:Homo sapiens


Alignment Length:338 Identity:65/338 - (19%)
Similarity:109/338 - (32%) Gaps:121/338 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 RWANWEFHMSFDVRAGLVISLASIFDMDMNRYRQVLYKGHLSEMFVPYMDPNDDWYFISYLD--C 323
            ||.|..           .:..||.||:.           .|..:.:....|.|       :|  |
Human   147 RWTNMN-----------ALHYASYFDVP-----------ELIRVILKTSKPKD-------VDATC 182

  Fly   324 GEFGCGQTAVSLEPYTDCP----------PNAAFMDG-------IFPGQDGTPTKISNVMCIFEK 371
            .:|..| ||:.:..:..|.          .|.||.:.       :.|.....|.::::...|   
Human   183 SDFNFG-TALHIAAHNLCAGAVKTLLELGANPAFRNDKGQIPAEVVPDPVDMPLEMADAAAI--- 243

  Fly   372 YAGDIMWRHTEA-EVPGLKITEVRP--DVSLVARMVTTVGNYDYIIEYEFKPSGSIKMG--VGLT 431
             |.:|.....:| .:|......|.|  |.:....|:|::|               :|:|  |.:.
Human   244 -AKEIKQMLLDAVPLPCTSAKAVLPNSDHTTSRAMLTSLG---------------LKLGDRVVIA 292

  Fly   432 GVLEVKPVEYVHTSEIKEDDIYGTIVADNTVGVNHDHFVTFRLDLDIDGTENSFVRTELVTKRTP 496
            | .:|..:.:..|:|         ..:....|:..|         :.:|..|..|......|..|
Human   293 G-QKVGTLRFCGTTE---------FASGQWAGIELD---------EPEGKNNGSVGRVQYFKCAP 338

  Fly   497 KSVNTPRKSYWTTKRNTAKTEADARVKLGLRAEELVVVNPTK--KTKHGNEVGYRLLPG-----P 554
            |...|      |:|:.||             :|..:.:.|::  ||...|:...   ||     .
Human   339 KYGLT------TSKKETA-------------SESTLTLPPSEEPKTVAENDAAQ---PGSMSSSS 381

  Fly   555 ASSPLLVQDDYPQ 567
            :||.|..:..||:
Human   382 SSSSLDHKQSYPK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drlNP_001260566.1 WIF 21..157 CDD:128745
PTK_Ryk 336..606 CDD:270639 49/261 (19%)
MERTKNP_006334.2 Ig 111..176 CDD:409353 8/50 (16%)
Ig strand B 111..115 CDD:409353
Ig strand C 127..131 CDD:409353
Ig strand E 158..162 CDD:409353 2/3 (67%)
Ig strand F 172..176 CDD:409353 0/3 (0%)
IgI_2_Axl_Tyro3_like 198..279 CDD:409407 15/84 (18%)
Ig strand A 198..201 CDD:409407 1/2 (50%)
Ig strand A' 204..208 CDD:409407 0/3 (0%)
Ig strand B 212..221 CDD:409407 3/8 (38%)
Ig strand C 226..233 CDD:409407 1/6 (17%)
Ig strand C' 235..238 CDD:409407 0/2 (0%)
Ig strand E 243..254 CDD:409407 3/14 (21%)
Ig strand F 257..266 CDD:409407 1/8 (13%)
Ig strand G 270..279 CDD:409407 2/8 (25%)
FN3 284..378 CDD:238020 27/134 (20%)
FN3 386..478 CDD:238020 3/9 (33%)
PTKc_Mer 579..862 CDD:271106
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.