DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shark and AT5G01850

DIOPT Version :9

Sequence 1:NP_524743.2 Gene:Shark / 44353 FlyBaseID:FBgn0015295 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001332324.1 Gene:AT5G01850 / 831760 AraportID:AT5G01850 Length:357 Species:Arabidopsis thaliana


Alignment Length:323 Identity:88/323 - (27%)
Similarity:150/323 - (46%) Gaps:62/323 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   657 IEPEKLVLDREIGHGEFGSVHSGWLLRKSGAGEESRLEVAIKMLS-----DEHSN-KQEFLREAS 715
            ::|:.|.:..:||.|..|.|:.         |...|..||||:::     |:.|: :..|:||.:
plant    13 VDPKLLFIGSKIGEGAHGKVYQ---------GRYGRQIVAIKVVNRGSKPDQQSSLESRFVREVN 68

  Fly   716 VMMRLEHKCIVRL------------------------IGIAKGEMLMMVQELAPLGSMLQYILDH 756
            :|.|::|..:|::                        ||..|..::::|.||.|..|:.:|:...
plant    69 MMSRVQHHNLVKVSLLLSSLSLLSILLLEYTISIWQFIGACKDPLMVIVTELLPGMSLRKYLTSI 133

  Fly   757 GHEITANAELKVWASQIACGMHYLESQHFVHRDLAARNILLTARHQA-KISDFGMSRSLRPGSTE 820
            ..::........:|..||..:|.|.:...:||||...|:|||..|:: |::|||::|  ....||
plant   134 RPQLLHLPLALSFALDIARALHCLHANGIIHRDLKPDNLLLTENHKSVKLADFGLAR--EESVTE 196

  Fly   821 YQFTQGGRWPIRWYAPESFNLGI--------FSHASDVWSFGVTIWEMFSLGAPPYGEISNVDAI 877
            ....:.|.:  ||.|||.::...        :::..||:|||:.:||:.: ...|:..:||:.|.
plant   197 MMTAETGTY--RWMAPELYSTVTLRQGEKKHYNNKVDVYSFGIVLWELLT-NRMPFEGMSNLQAA 258

  Fly   878 KLVDSGERLP--QPNLCPAYIYAVMQSCWKERPKDRPTFV----YLTEFF--ARDPDYQNLPE 932
            ......:..|  ...:.|:..: ::||||.|.|..||:|.    .|.||.  ...|..|.|||
plant   259 YAAAFKQERPVMPEGISPSLAF-IVQSCWVEDPNMRPSFSQIIRLLNEFLLTLTPPPPQPLPE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SharkNP_524743.2 SH2_Nterm_shark_like 8..91 CDD:198210
Ank_2 <112..184 CDD:289560
ANK 117..241 CDD:238125
ANK repeat 124..151 CDD:293786
ANK repeat 153..184 CDD:293786
Ank_2 158..247 CDD:289560
ANK repeat 186..217 CDD:293786
ANK repeat 220..245 CDD:293786
Ank_4 224..274 CDD:290365
SH2_Cterm_shark_like 287..395 CDD:198211
TyrKc 662..921 CDD:197581 81/303 (27%)
PTKc_Syk_like 666..926 CDD:270650 81/306 (26%)
AT5G01850NP_001332324.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1725
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.