DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shark and Csk

DIOPT Version :9

Sequence 1:NP_524743.2 Gene:Shark / 44353 FlyBaseID:FBgn0015295 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_001291690.1 Gene:Csk / 12988 MGIID:88537 Length:450 Species:Mus musculus


Alignment Length:278 Identity:101/278 - (36%)
Similarity:153/278 - (55%) Gaps:25/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   650 AAKLRFF-----IEPEKLVLDREIGHGEFGSVHSGWLLRKSGAGEESRLEVAIKMLSDEHSNKQE 709
            ||:..|:     :..::|.|.:.||.||||.|.         .|:....:||:|.:.:: :..|.
Mouse   178 AAQDEFYRSGWALNMKELKLLQTIGKGEFGDVM---------LGDYRGNKVAVKCIKND-ATAQA 232

  Fly   710 FLREASVMMRLEHKCIVRLIGIAKGEM--LMMVQELAPLGSMLQYILDHGHEITANAELKVWASQ 772
            ||.|||||.:|.|..:|:|:|:...|.  |.:|.|....||::.|:...|..:.....|..::..
Mouse   233 FLAEASVMTQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLD 297

  Fly   773 IACGMHYLESQHFVHRDLAARNILLTARHQAKISDFGMSRSLRPGSTEYQFTQG-GRWPIRWYAP 836
            :...|.|||..:||||||||||:|::..:.||:||||:::       |...||. |:.|::|.||
Mouse   298 VCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTK-------EASSTQDTGKLPVKWTAP 355

  Fly   837 ESFNLGIFSHASDVWSFGVTIWEMFSLGAPPYGEISNVDAIKLVDSGERLPQPNLCPAYIYAVMQ 901
            |:.....||..|||||||:.:||::|.|..||..|...|.:..|:.|.::..|:.||..:|.||:
Mouse   356 EALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMK 420

  Fly   902 SCWKERPKDRPTFVYLTE 919
            :||......||||:.|.|
Mouse   421 NCWHLDAATRPTFLQLRE 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SharkNP_524743.2 SH2_Nterm_shark_like 8..91 CDD:198210
Ank_2 <112..184 CDD:289560
ANK 117..241 CDD:238125
ANK repeat 124..151 CDD:293786
ANK repeat 153..184 CDD:293786
Ank_2 158..247 CDD:289560
ANK repeat 186..217 CDD:293786
ANK repeat 220..245 CDD:293786
Ank_4 224..274 CDD:290365
SH2_Cterm_shark_like 287..395 CDD:198211
TyrKc 662..921 CDD:197581 98/261 (38%)
PTKc_Syk_like 666..926 CDD:270650 96/257 (37%)
CskNP_001291690.1 Interaction with PTPN22. /evidence=ECO:0000269|PubMed:8890164 9..70
SH3_CSK 11..67 CDD:212703
SH2_csk_like 78..175 CDD:198190
PTKc_Csk 188..443 CDD:133213 98/268 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0197
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.