DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shark and GRAP

DIOPT Version :10

Sequence 1:NP_524743.2 Gene:Shark / 44353 FlyBaseID:FBgn0015295 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_006604.1 Gene:GRAP / 10750 HGNCID:4562 Length:217 Species:Homo sapiens


Alignment Length:86 Identity:29/86 - (33%)
Similarity:50/86 - (58%) Gaps:6/86 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PMKWYHGNLSREAADELLKQGYEDGTFLVRESSTAAGDFVLSLLCQGEVCHYQVRRHGGEDAFFS 71
            |..||.|.:||:.|:|:|.:....|.||:|||.::.|:|.:|:....:|.|::|.|. ....:|.
Human    57 PHPWYSGRISRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLRE-ASGKYFL 120

  Fly    72 IDDKVQTKILHGLDTLVDYYQ 92
            .::|     .:.|:.|||:|:
Human   121 WEEK-----FNSLNELVDFYR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SharkNP_524743.2 SH2_Nterm_shark_like 8..91 CDD:198210 27/82 (33%)
ANKYR <94..317 CDD:440430
ANK repeat 124..151 CDD:293786
ANK repeat 153..184 CDD:293786
ANK repeat 186..217 CDD:293786
ANK repeat 220..245 CDD:293786
SH2_Cterm_shark_like 287..395 CDD:198211
PTKc_Syk_like 666..926 CDD:270650
GRAPNP_006604.1 SH3_GRAP_N 2..55 CDD:212881
SH2_Grb2_like 56..150 CDD:199828 29/86 (34%)
SH3_GRAP_C 162..214 CDD:212884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.