DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL12 and AT1G70190

DIOPT Version :9

Sequence 1:NP_524742.1 Gene:mRpL12 / 44326 FlyBaseID:FBgn0011787 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001185360.1 Gene:AT1G70190 / 843355 AraportID:AT1G70190 Length:208 Species:Arabidopsis thaliana


Alignment Length:204 Identity:60/204 - (29%)
Similarity:97/204 - (47%) Gaps:29/204 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RLALRQISRQVQL------HRMYSAAAPAAAVSGAE---KLVP----PA---PEGAAKPPNPKLD 53
            |..|.|.|.::.|      :|.|:..|........|   :.:|    ||   |.....||..::.
plant     8 RQHLSQTSSRLSLLSRIGGYRSYTQPAKIEDEEEEEFDQRKLPTDYDPATFDPTEHRSPPTDRVF 72

  Fly    54 SIVNNIAALNLLEVAELSTLLKQK---LNLPETAFAPQFA-------AGPARAAPAEDEEEAAPK 108
            .:|:.|::|.|||::||.:::.:|   ..||..|.....|       .|....:.:...|||..:
plant    73 RLVDEISSLTLLEISELGSIIMKKKGMTELPTVAVMKPGAGGGVGVGGGGGMVSQSGVSEEAKVE 137

  Fly   109 KVQTSFKVKLVKFDEKQKVALIKEVKNLLEGMNLVQAKKFVESAPTIVKEDIPKEEAEKLKEALS 173
            |  |.|::||..|:...|:.:|||:::..: :.|.:||..||..|.|:|..:.|||.||:.|.|.
plant   138 K--TVFEIKLESFEASAKIKIIKELRSFTD-LGLKEAKALVEKTPAILKAGLSKEEGEKILEKLK 199

  Fly   174 KAGAIIEIE 182
            ..||.:.:|
plant   200 ALGAKVVLE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL12NP_524742.1 Ribosomal_L12_N 51..>84 CDD:406671 11/35 (31%)
Ribosomal_L12 114..182 CDD:395430 25/67 (37%)
AT1G70190NP_001185360.1 Ribosomal_L7_L12 70..207 CDD:100102 44/139 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3846
eggNOG 1 0.900 - - E1_COG0222
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2340
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1626139at2759
OrthoFinder 1 1.000 - - FOG0001606
OrthoInspector 1 1.000 - - otm2600
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45987
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.