DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL12 and AT4G36420

DIOPT Version :9

Sequence 1:NP_524742.1 Gene:mRpL12 / 44326 FlyBaseID:FBgn0011787 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_195360.1 Gene:AT4G36420 / 829794 AraportID:AT4G36420 Length:179 Species:Arabidopsis thaliana


Alignment Length:194 Identity:62/194 - (31%)
Similarity:100/194 - (51%) Gaps:37/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HITRL--ALRQISRQVQL----HRMYSAAAPAAAVSGAEKLVPPAPEGAAKPPNPKLDSIVNNIA 60
            |.:|:  :....|..|||    .|.||:               ||.:      :..:..|||.::
plant    10 HFSRVLKSTETRSSSVQLFTIQSRSYSS---------------PATQ------SENVSKIVNELS 53

  Fly    61 ALNLLEVAELSTLLKQKLNLPE----TAFAPQFA---AGPARAAPAEDEEEAAPKKVQTSFKVKL 118
            .|.|||..:|:.:|:||||:.|    .|..|..:   :|.:::|..|.:|:  .|:.:|:|.|.|
plant    54 NLTLLETMDLTEILRQKLNISELPVMAAMMPGMSLPGSGASKSAGGEGKEK--KKEAKTAFDVML 116

  Fly   119 VKFDEKQKVALIKEVKNLLEGMNLVQAKKFVESAPTIVKEDIPKEEAEKLKEALSKAGAIIEIE 182
            ..:|...|:.:||||:. :..:.|.:||..||.|||::|:.:.||||||:.|.|...||.:.:|
plant   117 QAYDAVSKIKVIKEVRT-ITALGLKEAKDLVEKAPTLLKKGVSKEEAEKIIEKLKAVGAKVAME 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL12NP_524742.1 Ribosomal_L12_N 51..>84 CDD:406671 14/36 (39%)
Ribosomal_L12 114..182 CDD:395430 28/67 (42%)
AT4G36420NP_195360.1 Ribosomal_L7_L12 43..178 CDD:100102 50/137 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3846
eggNOG 1 0.900 - - E1_COG0222
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2340
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1626139at2759
OrthoFinder 1 1.000 - - FOG0001606
OrthoInspector 1 1.000 - - otm2600
orthoMCL 1 0.900 - - OOG6_100766
Panther 1 1.100 - - LDO PTHR45987
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.