DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL12 and RPL12-C

DIOPT Version :9

Sequence 1:NP_524742.1 Gene:mRpL12 / 44326 FlyBaseID:FBgn0011787 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_189423.1 Gene:RPL12-C / 822405 AraportID:AT3G27850 Length:187 Species:Arabidopsis thaliana


Alignment Length:151 Identity:51/151 - (33%)
Similarity:79/151 - (52%) Gaps:6/151 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SGAEKLVPPAPEGAAKPPNPKLDSIVNNIAALNLLEVAELSTLLKQKLNLPETAFAPQFAAGPAR 95
            |.:.:.:...|..|.:.|. |::.|.:.|::|.|.|...|...|:.|..:...:.||   |..|.
plant    42 SSSHRAINLRPISAVEAPE-KIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAP---AAAAV 102

  Fly    96 AAPAEDEEEAAPKKVQTSFKVKLVKFDEKQKVALIKEVKNLLEGMNLVQAKKFVESAPTIVKEDI 160
            |||| |...||..:.||.|.|.:.:.....::|:||.|: .|..:.|.:||:.:|..|...||.|
plant   103 AAPA-DGGAAAVVEEQTEFDVVINEVPSSSRIAVIKAVR-ALTSLALKEAKELIEGLPKKFKEGI 165

  Fly   161 PKEEAEKLKEALSKAGAIIEI 181
            .|:|||:.|:.|.:|||.:.|
plant   166 TKDEAEEAKKTLEEAGAKVSI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL12NP_524742.1 Ribosomal_L12_N 51..>84 CDD:406671 9/32 (28%)
Ribosomal_L12 114..182 CDD:395430 25/68 (37%)
RPL12-CNP_189423.1 Ribosomal_L7_L12 60..186 CDD:100102 46/131 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1626139at2759
OrthoFinder 1 1.000 - - FOG0001606
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100766
Panther 1 1.100 - - O PTHR45987
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.