DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL12 and RPL12-B

DIOPT Version :9

Sequence 1:NP_524742.1 Gene:mRpL12 / 44326 FlyBaseID:FBgn0011787 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_189422.1 Gene:RPL12-B / 822404 AraportID:AT3G27840 Length:193 Species:Arabidopsis thaliana


Alignment Length:141 Identity:41/141 - (29%)
Similarity:70/141 - (49%) Gaps:5/141 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PEGAAKPPNPKLDSIVNNIAALNLLEVAELSTLLKQKLNLPETAFAPQFAAGPARAAPAEDEEEA 105
            |..|.|.|. |:..|.:.|::|.|.|...|...::.|..:.....||..||.|   .|.::....
plant    57 PISAVKTPK-KIKKIGSEISSLTLEESRILVDYVQDKFGVSILFSAPAAAALP---PPLDNGGAT 117

  Fly   106 APKKVQTSFKVKLVKFDEKQKVALIKEVKNLLEGMNLVQAKKFVESAPTIVKEDIPKEEAEKLKE 170
            |..:.||:|.|.:.......::|:|..:: .:..::|.::|:.:|..|...||.:.|:|||:.|.
plant   118 ASVERQTTFDVVINDVPRGNRIAVITAIR-AMTSLSLSESKELIEGFPKKFKEGVTKDEAEEDKT 181

  Fly   171 ALSKAGAIIEI 181
            .|.:|||.:.|
plant   182 QLEEAGAKVSI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL12NP_524742.1 Ribosomal_L12_N 51..>84 CDD:406671 8/32 (25%)
Ribosomal_L12 114..182 CDD:395430 20/68 (29%)
RPL12-BNP_189422.1 rpl12 65..193 CDD:214358 37/133 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1626139at2759
OrthoFinder 1 1.000 - - FOG0001606
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100766
Panther 1 1.100 - - O PTHR45987
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.