DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL12 and RPL12-A

DIOPT Version :9

Sequence 1:NP_524742.1 Gene:mRpL12 / 44326 FlyBaseID:FBgn0011787 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001326742.1 Gene:RPL12-A / 822403 AraportID:AT3G27830 Length:191 Species:Arabidopsis thaliana


Alignment Length:156 Identity:54/156 - (34%)
Similarity:78/156 - (50%) Gaps:21/156 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PAAAVSGAEKLVPPAPEGAAKPPNPKLDSIVNNIAALNLLEVAELSTLLKQKLNLPETAFAPQFA 90
            |.|||.        |||        |::.|.:.|::|.|.|...|...|:.|..:...:.||   
plant    56 PIAAVE--------APE--------KIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAP--- 101

  Fly    91 AGPARAAPAEDEEEAAPKKVQTSFKVKLVKFDEKQKVALIKEVKNLLEGMNLVQAKKFVESAPTI 155
            |..|.|||| |...||..:.||.|.|.:.:.....::|:||.|: .|..:.|.:||:.:|..|..
plant   102 AAAAVAAPA-DGGAAAVVEEQTEFDVVINEVPSSSRIAVIKAVR-ALTSLALKEAKELIEGLPKK 164

  Fly   156 VKEDIPKEEAEKLKEALSKAGAIIEI 181
            .||.|.|:|||:.|:.|.:|||.:.|
plant   165 FKEGITKDEAEEAKKTLEEAGAKVSI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL12NP_524742.1 Ribosomal_L12_N 51..>84 CDD:406671 9/32 (28%)
Ribosomal_L12 114..182 CDD:395430 25/68 (37%)
RPL12-ANP_001326742.1 Ribosomal_L7_L12 64..190 CDD:100102 47/138 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1626139at2759
OrthoFinder 1 1.000 - - FOG0001606
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100766
Panther 1 1.100 - - O PTHR45987
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.