DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL12 and AT3G06040

DIOPT Version :9

Sequence 1:NP_524742.1 Gene:mRpL12 / 44326 FlyBaseID:FBgn0011787 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001078113.1 Gene:AT3G06040 / 819777 AraportID:AT3G06040 Length:186 Species:Arabidopsis thaliana


Alignment Length:190 Identity:56/190 - (29%)
Similarity:86/190 - (45%) Gaps:12/190 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHITRLALRQISRQVQLHRMYSAAAPAAAVSGAEKLVP-----PA---PEGAAKPPNPKLDSIVN 57
            |.:..|.....|||.|...::|............|..|     |:   |.|....|:.|:..:..
plant     1 MKLISLVRNVRSRQCQPEVIWSVQVRFLQQDSVSKAKPKKYKYPSVYDPYGPRPQPSSKIMELAE 65

  Fly    58 NIAALNLLEVAELSTLLKQKLNLPETAFAPQFAAGPARAAPAEDEEEAAPKKVQTSFKVKLVKFD 122
            .||||:..|..::...|.:.|.||:.........|..:...|.:.||   ||.:|:|.|||.||:
plant    66 RIAALSPEERKQIGPALNEHLRLPKQQMISSDGIGAKQDTGAGNVEE---KKEKTAFDVKLEKFN 127

  Fly   123 EKQKVALIKEVKNLLEGMNLVQAKKFVESAPTIVKEDIPKEEAEKLKEALSKAGAIIEIE 182
            ...|:.:||||:. ...:.|.:||:.||..|.|:|:.:.||||.::...:...|.|..:|
plant   128 ASDKIKVIKEVRT-FTSLGLKEAKELVEKVPAILKQGVTKEEANEIIAKIKAVGGIAVME 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL12NP_524742.1 Ribosomal_L12_N 51..>84 CDD:406671 10/32 (31%)
Ribosomal_L12 114..182 CDD:395430 25/67 (37%)
AT3G06040NP_001078113.1 rpl12 57..181 CDD:214358 40/127 (31%)
Ribosomal_L7_L12 59..185 CDD:100102 42/129 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3846
eggNOG 1 0.900 - - E1_COG0222
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2340
OMA 1 1.010 - - QHG54119
OrthoDB 1 1.010 - - D1626139at2759
OrthoFinder 1 1.000 - - FOG0001606
OrthoInspector 1 1.000 - - otm2600
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45987
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.