DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL12 and AT2G03130

DIOPT Version :9

Sequence 1:NP_524742.1 Gene:mRpL12 / 44326 FlyBaseID:FBgn0011787 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_178412.1 Gene:AT2G03130 / 814842 AraportID:AT2G03130 Length:110 Species:Arabidopsis thaliana


Alignment Length:90 Identity:33/90 - (36%)
Similarity:50/90 - (55%) Gaps:11/90 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QFAAGPARAAPAEDEEEAAPKKVQTSFKVKLVKFDEKQKVALIKEVKNLLEGMNLVQAKKFVESA 152
            |...|....|.||          :|.|:|||..|:.:.|:.:||||:.:: |:.|.:|.|.|..|
plant     8 QSGGGANEGAKAE----------KTVFEVKLESFEARAKIKIIKEVRRII-GVGLKEAMKLVVKA 61

  Fly   153 PTIVKEDIPKEEAEKLKEALSKAGA 177
            ||::|..:.|||.|::.|.|:..||
plant    62 PTVLKTGLSKEEGEEVVEKLNALGA 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL12NP_524742.1 Ribosomal_L12_N 51..>84 CDD:406671
Ribosomal_L12 114..182 CDD:395430 27/64 (42%)
AT2G03130NP_178412.1 Ribosomal_L7_L12 <9..90 CDD:100102 32/89 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3846
eggNOG 1 0.900 - - E1_COG0222
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001606
OrthoInspector 1 1.000 - - otm2600
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.