DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL12 and mrpl12

DIOPT Version :9

Sequence 1:NP_524742.1 Gene:mRpL12 / 44326 FlyBaseID:FBgn0011787 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001006886.1 Gene:mrpl12 / 448724 XenbaseID:XB-GENE-1005183 Length:189 Species:Xenopus tropicalis


Alignment Length:187 Identity:75/187 - (40%)
Similarity:109/187 - (58%) Gaps:8/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ITRLALRQISRQVQLHRMYSAAAPAAAVSGAEK---LVPPAPEGAAKPPNPKLDSIVNNIAALNL 64
            :||..||..:....|.|...:.......:...|   |..|:.:.|.|...||:.::|:.||:|.|
 Frog     4 VTRCCLRLQAVSSALRRFEISTVRLLRTTSELKNQALPSPSLDNAPKEYPPKIHNLVDQIASLTL 68

  Fly    65 LEVAELSTLLKQKLNLPETAFAP--QFAAGPARAAPAEDEEEA-AP-KKVQTSFKVKLVKFDEKQ 125
            |||:|.:.||::.|.:.:....|  ...:| |.|||::..||| || ||.:|.|.|||.:.:...
 Frog    69 LEVSEFNELLRKTLKIQDVGMMPMGSMLSG-ATAAPSQAAEEAEAPGKKEKTHFTVKLTEVNATD 132

  Fly   126 KVALIKEVKNLLEGMNLVQAKKFVESAPTIVKEDIPKEEAEKLKEALSKAGAIIEIE 182
            ||.|||||||.::|:|||||||.||:.|..:|.::.|:||||:|.||..||..:.:|
 Frog   133 KVKLIKEVKNCIQGLNLVQAKKLVEALPQEIKANVSKDEAEKIKAALEAAGGKVALE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL12NP_524742.1 Ribosomal_L12_N 51..>84 CDD:406671 13/32 (41%)
Ribosomal_L12 114..182 CDD:395430 35/67 (52%)
mrpl12NP_001006886.1 Ribosomal_L7_L12 54..188 CDD:100102 63/134 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9216
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2212
Inparanoid 1 1.050 115 1.000 Inparanoid score I4684
OMA 1 1.010 - - QHG54119
OrthoDB 1 1.010 - - D1626139at2759
OrthoFinder 1 1.000 - - FOG0001606
OrthoInspector 1 1.000 - - oto104350
Panther 1 1.100 - - LDO PTHR45987
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R727
SonicParanoid 1 1.000 - - X5038
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.