DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and CML23

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_564874.1 Gene:CML23 / 842958 AraportID:AT1G66400 Length:157 Species:Arabidopsis thaliana


Alignment Length:151 Identity:48/151 - (31%)
Similarity:74/151 - (49%) Gaps:23/151 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KRFRKLDLDNSGALSIDEFMSL-----PELQQNPLVQRVIDIFDADGNGEVDFKEFIQ--GVSQF 82
            |.|::.|.:|.|.:||||...:     |...|.. .:.::..||.||||.:|..||:.  .:|..
plant    18 KVFQRFDKNNDGKISIDELKDVIGALSPNASQEE-TKAMMKEFDLDGNGFIDLDEFVALFQISDQ 81

  Fly    83 SVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTICFADKDEDGK 147
            |.....:..|:.||.:||:|.:|.||..||..|:|.: |........|::::|    .|.|.||.
plant    82 SSNNSAIRDLKEAFDLYDLDRNGRISANELHSVMKNL-GEKCSIQDCQRMINK----VDSDGDGC 141

  Fly   148 ISFDEFCSVVGNTDIHKKMVV 168
            :.|:||          |||::
plant   142 VDFEEF----------KKMMM 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 44/135 (33%)
CML23NP_564874.1 PTZ00184 13..152 CDD:185504 48/149 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.