DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and AT5G17470

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_197249.1 Gene:AT5G17470 / 831613 AraportID:AT5G17470 Length:146 Species:Arabidopsis thaliana


Alignment Length:139 Identity:42/139 - (30%)
Similarity:65/139 - (46%) Gaps:23/139 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID-IF---DADGNGEVDFKEFIQGVSQFSVRGD 87
            |.::|.:..|.:|.|||..........:....|| :|   |.||:.::|..|:...: .....|:
plant     7 FERVDKNKDGKISWDEFAEAIRAFSPSITSEEIDNMFREIDVDGDNQIDVAEYASCL-MLGGEGN 70

  Fly    88 KLSK---LRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTICFA-----DKDE 144
            |..:   ::.||.:||:|.||.||..|:..|||.:       .:.|.|.:   |.|     |.|.
plant    71 KEDEDIVMKEAFDLYDIDGDGKISASEIHVVLKRL-------GEKQTIAE---CIAMVRAVDADG 125

  Fly   145 DGKISFDEF 153
            ||.:||:||
plant   126 DGFVSFEEF 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 42/139 (30%)
AT5G17470NP_197249.1 EF-hand_7 5..60 CDD:290234 15/52 (29%)
EFh 5..58 CDD:238008 14/50 (28%)
EF-hand_7 78..138 CDD:290234 25/67 (37%)
EFh 79..139 CDD:238008 25/66 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.