DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and CBL6

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001328805.1 Gene:CBL6 / 827330 AraportID:AT4G16350 Length:226 Species:Arabidopsis thaliana


Alignment Length:159 Identity:49/159 - (30%)
Similarity:80/159 - (50%) Gaps:12/159 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PMDMCSN--FDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNP----LVQRVIDIFDADG 66
            |.|:...  |..:||..|.:.|:  .:..:|.:..::| .|...:.|.    ...||.|:||...
plant    31 PKDVARGTVFTVNEIEALYELFK--SISKNGLIDKEQF-QLVLFKMNTTRSLFADRVFDLFDTKN 92

  Fly    67 NGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV---GNNLKDTQ 128
            .|.:||:.|.:.:|.|........|:.|:|::||::..|||...|:.|::...:   |.||.|..
plant    93 TGILDFEAFARSLSVFHPNAKFEDKIEFSFKLYDLNQQGYIKRQEVKQMVVRTLAESGMNLSDHV 157

  Fly   129 LQQIVDKTICFADKDEDGKISFDEFCSVV 157
            ::.|:|||...||...||||..:|:.|:|
plant   158 IESIIDKTFEEADTKLDGKIDKEEWRSLV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 45/149 (30%)
CBL6NP_001328805.1 FRQ1 38..192 CDD:227455 47/152 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I4251
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.