DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and CBL5

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_192051.2 Gene:CBL5 / 826671 AraportID:AT4G01420 Length:203 Species:Arabidopsis thaliana


Alignment Length:151 Identity:44/151 - (29%)
Similarity:72/151 - (47%) Gaps:16/151 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FDADEIRRLGKRFRKLD--LDNSGALSID--EFMSLPELQQNPL-VQRVIDIFDADGNGEVDFKE 74
            |...|:..|...|.||.  |.|...|:.:  :|:.:...::..| .:|:..:||...:|.:||.|
plant    26 FSEAEVEVLHGLFIKLTSCLSNDNLLTKEKFQFILIKNTKKRSLSAERIFGLFDMRNDGAIDFGE 90

  Fly    75 FIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQL-------QQI 132
            |:..::.|........|..||||:||....|:|...|    :|.|:.:.|::::|       ..|
plant    91 FVHTLNIFHPNSSPRDKAIFAFRLYDTRETGFIEPEE----VKEMIIDVLEESELMLSESIIDSI 151

  Fly   133 VDKTICFADKDEDGKISFDEF 153
            |.||...||..:||.|..:|:
plant   152 VSKTFEEADWKKDGIIDLEEW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 44/151 (29%)
CBL5NP_192051.2 FRQ1 13..181 CDD:227455 44/151 (29%)
EFh 71..132 CDD:298682 20/64 (31%)
EFh 107..172 CDD:238008 23/68 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.