powered by:
Protein Alignment CanB and AT3G59450
DIOPT Version :9
Sequence 1: | NP_001245531.1 |
Gene: | CanB / 44317 |
FlyBaseID: | FBgn0010014 |
Length: | 170 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_191504.1 |
Gene: | AT3G59450 / 825114 |
AraportID: | AT3G59450 |
Length: | 148 |
Species: | Arabidopsis thaliana |
Alignment Length: | 42 |
Identity: | 17/42 - (40%) |
Similarity: | 24/42 - (57%) |
Gaps: | 5/42 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 GALSIDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQ 77
||:| ||.|.:.....:.:|...|.||:|.||:|||:|
plant 102 GAVS-----SLKEGKALECCKEMIKQVDEDGHGRVDYKEFLQ 138
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CanB | NP_001245531.1 |
FRQ1 |
13..154 |
CDD:227455 |
17/42 (40%) |
AT3G59450 | NP_191504.1 |
EFh |
<96..141 |
CDD:238008 |
17/42 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1271942at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.