DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and AT3G18430

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001189924.1 Gene:AT3G18430 / 821372 AraportID:AT3G18430 Length:175 Species:Arabidopsis thaliana


Alignment Length:179 Identity:51/179 - (28%)
Similarity:99/179 - (55%) Gaps:16/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSL--------PMDMCSN-FDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQ 56
            |||.:|:        ....|.: |:..||..|.:||.:||.:..|.:|.|||:|:||...|||.|
plant     1 MGNTSSMLTQYDIEEVQSHCHDLFEQQEILSLYQRFCQLDRNAKGFISADEFLSVPEFAMNPLSQ 65

  Fly    57 RVIDIFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVG 121
            |::.:.|.     ::||:|:..:|.||.:.....|::..|::||.|.:|.:|..::.:||:.:.|
plant    66 RLLKMVDG-----LNFKDFVAFLSAFSAKASLRQKVQLIFKVYDSDCNGKVSFKDIMEVLRDLSG 125

  Fly   122 NNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV 170
            :.:.|.|.:|::.:.:..:....|..::.::|..:.|::  ..:|.|::
plant   126 SFMSDEQREQVLSQVLKESGYTSDSFLTLEDFIKIFGSS--RPEMDVEI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 42/141 (30%)
AT3G18430NP_001189924.1 FRQ1 24..161 CDD:227455 43/141 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68099
Inparanoid 1 1.050 91 1.000 Inparanoid score I2267
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 1 1.000 - - otm2564
orthoMCL 1 0.900 - - OOG6_101614
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.