DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and AT3G03400

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_186990.1 Gene:AT3G03400 / 821266 AraportID:AT3G03400 Length:137 Species:Arabidopsis thaliana


Alignment Length:136 Identity:41/136 - (30%)
Similarity:61/136 - (44%) Gaps:23/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FRKLDLDNSGALSIDEFMSL-----PELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQF--SV 84
            |.:.|....|.:|.:||...     |.:....||:..|.: |.:|:|:||..:|...:.|.  |.
plant    10 FERFDTSKDGKISWEEFRDAIHALSPSIPSEKLVEMFIQL-DTNGDGQVDAAKFASCMDQTAQSS 73

  Fly    85 RGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTICFA-----DKDE 144
            .||...:|:.||::||::.||.||..||..|:          |:|.:......|..     |.|.
plant    74 GGDVEKELKDAFKLYDINCDGKISANELHVVM----------TRLGEKCTVESCVGMVQAIDVDG 128

  Fly   145 DGKISF 150
            ||.|.|
plant   129 DGYIRF 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 41/136 (30%)
AT3G03400NP_186990.1 PTZ00184 10..134 CDD:185504 40/134 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.