DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB and AT3G03410

DIOPT Version :9

Sequence 1:NP_001245531.1 Gene:CanB / 44317 FlyBaseID:FBgn0010014 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_186991.1 Gene:AT3G03410 / 821262 AraportID:AT3G03410 Length:131 Species:Arabidopsis thaliana


Alignment Length:136 Identity:41/136 - (30%)
Similarity:65/136 - (47%) Gaps:20/136 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 FRKLDLDNSGALSIDEFMSL-----PELQQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVRG 86
            |.|.|.:..|.||:|||..:     |...|..:| :..:..|.|||||::..||...:       
plant     7 FEKFDKNKDGKLSLDEFREVALAFSPYFTQEDIV-KFFEEIDVDGNGELNADEFTSCI------- 63

  Fly    87 DKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTICFADKDEDGKISFD 151
            :|:.|..|.|  .|:|.||.|...|.:..:..:.....::|..::     :..||.|.||.::||
plant    64 EKMLKEVFVF--CDVDGDGKIPASESYVTMTSLGKKFTEETSAEK-----VRAADVDGDGYLNFD 121

  Fly   152 EFCSVV 157
            ||.::|
plant   122 EFMALV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanBNP_001245531.1 FRQ1 13..154 CDD:227455 39/131 (30%)
AT3G03410NP_186991.1 PTZ00184 4..128 CDD:185504 41/136 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.